Analytical Data
-
Gene name
RPE
-
简介
RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Ribulose-Phosphate 3-Epimerase; RPE; HUSSY-17
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8VEE0
-
Expression Region
M1-R228
-
AA Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR
-
Protein Length
Full Length
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPE (Retinal Pigment Epithelium) recombinant proteins have garnered significant attention in recent years due to their potential role in understanding retinal diseases and advancing therapeutic strategies. The RPE is a crucial layer of cells in the retina, responsible for various functions including the support of photoreceptor cells, maintenance of the blood-retinal barrier, and regeneration of visual pigments. Dysfunction or degeneration of RPE cells is implicated in several ocular diseases, such as age-related macular degeneration (AMD) and retinal dystrophies. Research on RPE recombinant proteins aims to elucidate their structural and functional properties, which may lead to innovative treatments. These proteins can be utilized to create bioassays, model retinal diseases, and facilitate drug discovery. By producing and characterizing RPE recombinant proteins, scientists seek to gain deeper insights into the molecular mechanisms underlying retinal pathology, paving the way for regenerative medicine approaches and the development of targeted therapies. The exploration of RPE recombinant proteins not only enhances our understanding of retinal biology but also holds promise for the future of vision restoration and preservation in patients affected by debilitating retinal conditions.
