Analytical Data
-
Gene name
FCN2
- Application
-
Alternative Names
Ficolin-2; 37 kDa elastin-binding protein; Collagen/fibrinogen domain-containing protein 2; EBP-37; Ficolin-B; Ficolin-beta; FCNL
-
Species
Human
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15485-1
-
Expression Region
L26-A313
-
AA Sequence
LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibronectin type III domain-containing protein 2 (FCN2), also known as fetal liver kinase 1 (Flk-1), is a key player in the immune response, particularly in the innate immune system. This protein is primarily synthesized by liver and immune cells, and it plays a crucial role in recognizing pathogens and modulating inflammatory responses. FCN2 functions through a lectin-like mechanism that binds to specific carbohydrates on the surfaces of pathogens, thereby facilitating opsonization and subsequent phagocytosis by immune cells. Research on FCN2 has gained momentum due to its potential therapeutic applications in managing infections and inflammatory diseases. The recombinant form of FCN2 has been increasingly studied for its functional properties, including its ability to enhance immune signaling pathways and its protective effects against various pathogens. Insights into its structure-function relationships have paved the way for engineering improved variants, which could serve as novel immunotherapeutics. Moreover, understanding the genetic and environmental factors that influence FCN2 expression is fundamental in deciphering its role in disease susceptibility and progression. As researchers continue to investigate the various aspects of FCN2, including its mechanisms of action and interactions with other immune components, it stands as a promising candidate for developing targeted therapies aimed at enhancing host defense mechanisms and mitigating inflammatory responses in clinical settings.
