Analytical Data
-
Gene name
TFPI2
-
简介
TFPI2 (tissue factor pathway inhibitor 2) is a key regulator of matrix remodeling and has inhibitory control effects on trypsin, plasmin and factor VIIa/tissue factor. It has a weak effect on factor Xa and has no effect on thrombin. Its complex interactions extend to the formation of molecular complexes with ABCB1 and PPP2R3C, resulting in dephosphorylation of ABCB1. TFPI2 Protein, Mouse (189a.a, HEK293, His) is the recombinant mouse-derived TFPI2 protein, expressed by HEK293 , with His labeled tag.
- Application
-
Alternative Names
Tissue factor pathway inhibitor 2; TFPI-2;
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O35536
-
Expression Region
L23-K211
-
AA Sequence
LTSVSAQGNNLEICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTCGSIEKVPPVCRSELKTYPCDKPNIRFFFNLNTMTCEPLRPGLCSRTINVFSEEATCKGLCEPRKHIPSFCSSPKDEGLCSANVTRFYFNSRNKTCETFTYTGCGGNENNFYYLDACHRACVKGWK
-
Protein Length
Partial
-
Molecular Weight
25-35 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TFPI2 (Tissue Factor Pathway Inhibitor 2) is a serine protease inhibitor that plays a critical role in regulating the extrinsic pathway of blood coagulation, particularly through its interaction with tissue factor (TF) and factor VIIa. Initially identified in human tissues, TFPI2 has drawn significant attention due to its potential implications in various pathological conditions, including cancer metastasis, thrombosis, and cardiovascular diseases. The expression of TFPI2 is often dysregulated in tumors, making it a candidate for therapeutic strategies aimed at inhibiting tumor growth and spread. Furthermore, recombinant TFPI2 has been developed to explore its functional properties and therapeutic applications, as it can modulate pro-coagulation and inflammation processes. Studies have focused on the biological activity of the recombinant protein, its mechanism of action, and its potential as a biomarker for disease progression. Understanding the structural and functional aspects of TFPI2 may lead to novel approaches in treating coagulation disorders and improving cancer therapies, highlighting the importance of this protein in both hemostasis and tumor biology.
