Analytical Data
-
Gene name
Apolipoprotein A-I/APOA1
-
简介
The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Apolipoprotein L1; Apo-L; ApoL-I; APOL1; APOL
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00623
-
Expression Region
W19-Q264
-
AA Sequence
WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
26-28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein A-I (ApoA-I) is a crucial protein component of high-density lipoprotein (HDL) in the human body, playing a vital role in lipid metabolism and cardiovascular health. It serves not only as a structural protein for HDL but also functions as a key player in reverse cholesterol transport, facilitating the removal of excess cholesterol from peripheral tissues to the liver for excretion. Given its protective role against atherosclerosis and cardiovascular diseases, recombinant ApoA-I protein has become a focus of research in recent years. Advances in biotechnology have enabled the production of recombinant ApoA-I, allowing scientists to explore its structure, function, and potential therapeutic applications. Studies have investigated the use of recombinant ApoA-I in various contexts, including its ability to modify HDL properties, enhance cholesterol mobilization, and exert anti-inflammatory effects. Furthermore, recombinant ApoA-I is being evaluated as a possible therapeutic agent for patients with low HDL levels or those at high risk for cardiovascular events. Understanding the mechanisms through which ApoA-I operates could lead to innovative treatments aimed at improving cardiovascular health and managing lipid disorders, emphasizing its significance in modern biomedical research.
