Analytical Data
-
Gene name
NucA
-
简介
The NucA protein plays a central role in cellular processes because it catalyzes the hydrolysis of DNA and RNA (both double- and single-stranded) at the 3' position of the phosphodiester bond to generate 5'-phosphorylated single- and double-stranded , tri- and tetra-nucleotides. This multifunctional enzymatic activity emphasizes the importance of NucA in nucleic acid metabolism, as observed in various studies. NucA Protein, S. marcescens is the recombinant NucA protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Nuclease; nucA; Endonuclease; nuc; Benzonase Nuclease
-
Species
Others
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P13717
-
Expression Region
M1-N266
-
AA Sequence
MRFNNKMLALAALLFAAQASADTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN
-
Protein Length
Full Length
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NucA is a crucial enzyme involved in the metabolism of nucleotides and nucleic acids, primarily identified in various microorganisms, including bacteria. It belongs to the Nuc family of nucleases and plays a pivotal role in DNA replication, repair, and degradation processes. The study of NucA recombinant proteins has gained significant attention due to their potential applications in biotechnology and medicine. Understanding the structure and function of NucA can provide insights into its enzymatic mechanisms, which could be leveraged for therapeutic purposes, such as developing novel antimicrobial agents targeting pathogenic bacteria. Additionally, recombinant NucA proteins serve as valuable tools in molecular biology research, facilitating the analysis of nucleic acid interactions and functions. The expression and purification of recombinant NucA allow for detailed studies on its enzymatic activity, substrate specificity, and biochemical properties. This research not only enhances our understanding of the fundamental biological processes involving nucleic acids but also opens avenues for innovative applications in genetic engineering and synthetic biology, making NucA a protein of substantial interest in contemporary scientific studies.
