Analytical Data
-
Gene name
FSHR
-
简介
FSHR, a G protein-coupled receptor, specifically recognizes follitropin (FSH) and activates PI3K-AKT and ERK1/ERK2 pathways by promoting cAMP production. Operating as a homotrimer, FSHR binds the heterodimeric FSH hormone, forming a functional unit for signal transduction. Its regulatory mechanisms involve interaction with ARRB2, and independently of FSH stimulation, it engages with APPL2, demonstrating versatility in diverse cellular contexts. FSHR Protein, Human (His) is the recombinant human-derived FSHR protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Biological Activity
Immobilized Human FSH at 2 μg/mL (100 μL/well) can bind Human FSHR. The ED50 for this effect is 0.265 μg/mL. Immobilized Human FSH at 2 μg/mL (100 μL/well) can bind Human FSHR. The ED50 for this effect is 0.265 μg/mL.
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23945-1
-
Expression Region
C18-R366
-
AA Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
-
Protein Length
Extracellular Domain
-
Molecular Weight
47-51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Follicle-stimulating hormone receptor (FSHR) is a critical protein involved in the regulation of reproductive processes by mediating the actions of follicle-stimulating hormone (FSH). FSH plays a vital role in the development of ovarian follicles in females and spermatogenesis in males. Abnormalities in FSHR signaling can lead to various reproductive disorders, such as infertility, ovarian hyperstimulation syndrome, and hypogonadism. Given its central role in reproductive health, FSHR has become a significant target for therapeutic interventions. Researchers have focused on the generation of recombinant FSHR proteins to facilitate structural and functional studies, enabling a better understanding of its signaling mechanisms. These reconstituted proteins can be used to study receptor pharmacology, develop novel contraceptive methods, and create treatments for fertility-related issues. Recent advancements in protein engineering techniques have improved the yield and functionality of these recombinant proteins, allowing for high-precision studies that could lead to breakthroughs in reproductive health therapies. The ongoing exploration of FSHR and its interactions continues to provide valuable insights into reproductive biology and potential clinical applications.
