Cat: IPD-X35326

Recombinant Mouse Renin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Renin

  • 简介

    Renin Protein, a highly specific endopeptidase, generates angiotensin I from angiotensinogen, initiating a cascade that elevates blood pressure and enhances kidney sodium retention.Renin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Renin-1; Angiotensinogenase; Kidney renin; Ren1; Ren; Ren-1

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06281

  • Expression Region

    L22-R402

  • AA Sequence

    LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    48-60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Renin, an essential enzyme in the renin-angiotensin system (RAS), plays a pivotal role in regulating blood pressure and fluid balance. It is produced primarily in the kidneys and initiates the conversion of angiotensinogen to angiotensin I, which subsequently influences vasoconstriction and aldosterone secretion. Aberrations in renin activity are associated with various cardiovascular and renal disorders, including hypertension, heart failure, and chronic kidney disease. Given its significance, the study of recombinant renin has gained attention as a means to understand its biochemical properties and functional mechanisms. Recombinant proteins allow for detailed investigations into renin's structure-function relationships and its interactions with other components of the RAS. Moreover, the development of recombinant renin provides opportunities for therapeutic applications, such as the development of novel antihypertensive drugs that target this pathway. Advances in biotechnology have facilitated the production of high-purity recombinant renin, making it possible to perform in-depth studies and assays that were previously challenging due to the difficulty of isolating the native enzyme. As a result, research on recombinant renin not only enhances our understanding of hypertension and related diseases but also paves the way for innovative treatment strategies to manage these conditions effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US