Analytical Data
-
Gene name
CCR9
-
简介
CCR9 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
- Application
-
Alternative Names
chemokine (C-C motif) receptor 9; GPR28; C-C chemokine receptor type 9; CDw199; GPR 9 6; G protein-coupled receptor 28; GPR-9-6; CC-CKR-9;
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51686-1
-
Expression Region
M1-L369
-
AA Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR9 (C-C chemokine receptor 9) is a vital chemokine receptor that plays a significant role in the immune system, particularly in mediating the trafficking of T cells to inflammatory sites, such as the gastrointestinal tract. This receptor is predominantly expressed in cells involved in mucosal immunity, making it a critical target for studying conditions such as inflammatory bowel disease (IBD) and other autoimmune disorders. The interest in CCR9 has intensified due to its potential as a therapeutic target, as blocking its function could help ameliorate the pathological accumulation of inflammatory cells in the gut. Recent advancements in recombinant protein technologies have facilitated the production and characterization of CCR9 and its ligands, enabling researchers to investigate the receptor's structure, signaling pathways, and interactions with ligands at a molecular level. Additionally, recombinant CCR9 proteins can be utilized in the development of specific blockers or antagonists, which hold promise for novel treatments. Understanding the functional dynamics of CCR9 through recombinant protein studies is thus essential for advancing our knowledge of immune regulation and developing innovative strategies to manage immune-mediated diseases.











