Analytical Data
-
Gene name
IRS1
- Application
-
Alternative Names
IRS1；Insulin receptor substrate 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35568
-
Expression Region
157-267aa
-
AA Sequence
GPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
-
Molecular Weight
60.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IRS1 (Insulin Receptor Substrate 1) is a crucial adaptor protein involved in insulin signaling and metabolic regulation. It plays a vital role in mediating the effects of insulin and other growth factors by facilitating communication between the insulin receptor and downstream signaling pathways, including the PI3K-AKT and MAPK pathways. Recent research has indicated that IRS1 is not only important for glucose homeostasis but also influences lipid metabolism and cellular growth. Dysregulation or mutations in IRS1 are associated with various metabolic disorders, including obesity, type 2 diabetes, and insulin resistance. As such, IRS1 has garnered significant interest in the fields of endocrinology and metabolic research. Researchers are investigating IRS1's structure-function relationships, its post-translational modifications, and its interactions with other signaling proteins to better understand how it regulates metabolic processes. The study of recombinant IRS1 proteins is pivotal in these investigations, as it allows for detailed analyses of its biochemical properties and the effects of specific mutations. Overall, the exploration of IRS1, particularly through recombinant protein studies, holds promise for developing therapeutic strategies aimed at improving metabolic health and addressing associated diseases.
