Analytical Data
-
Gene name
AIF1L
- Application
-
Alternative Names
AIF1L；C9orf58；IBA2；Allograft inflammatory factor 1-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQI0
-
Expression Region
1-150aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSGELSNRFQGGKAFGLLKARQERRLAEIN REFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLG VPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKA NESSPKPVGPPPERDIASLP
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AIF1L, or Apoptosis-Inducing Factor 1-Like, is a protein closely related to AIF1, which plays a crucial role in various cellular processes including apoptosis, inflammation, and cell differentiation. AIF1L has gained attention in recent years due to its potential implications in neurodegenerative disorders, cardiac diseases, and cancer. Research indicates that AIF1L may be involved in mitochondrial function and cellular stress responses. Understanding the structure and function of AIF1L is essential for elucidating its role in these pathological conditions. The study of AIF1L recombinant proteins allows researchers to investigate its biochemical properties, interactions with other cellular components, and its mechanism of action. By conducting experimental approaches such as protein expression, purification, and functional assays, scientists aim to define how AIF1L contributes to cellular homeostasis and how its dysregulation could lead to disease. Furthermore, AIF1L's potential as a biomarker or therapeutic target in various diseases warrants further investigation, making it a significant focus within the field of molecular and cellular biology. The ongoing studies on AIF1L are expected to provide deeper insights into its biological significance and pave the way for novel therapeutic strategies.
