Analytical Data
-
Gene name
FAM3D
- Application
-
Alternative Names
FAM3D；Protein FAM3D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BQ1
-
Expression Region
26-224aa
-
AA Sequence
YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAA NVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGD VMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGF RDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPFV DHHHHHH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM3D, a member of the FAM3 protein family, is increasingly recognized for its potential roles in various biological processes and diseases. Emerging research has illuminated FAM3D's involvement in regulating immune responses, cell differentiation, and metabolic pathways, making it a focus of interest in both fundamental and applied biomedical research. The protein has been linked to conditions such as cancer, obesity, and diabetes, prompting scientists to explore its mechanistic roles further. Studies have demonstrated that FAM3D can influence cell signaling pathways, including those associated with inflammation and apoptosis. Moreover, the recombinant expression of FAM3D provides a platform for investigating its biological functions and therapeutic potentials. By producing FAM3D as a recombinant protein, researchers can study its interactions with other cellular components, elucidate its role in pathophysiology, and evaluate its potential as a biomarker or therapeutic target. This line of inquiry not only enhances our understanding of FAM3D’s specific functions but also contributes to the broader knowledge of FAM3 proteins in health and disease, paving the way for future therapeutic developments.
