Cat: PA1000-102DB

Recombinant Human AK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AK4;GCN2;KIAA1338;eIF-2-alpha kinase GCN2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27144

  • Expression Region

    1-223aa

  • AA Sequence

    MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY

  • Molecular Weight

    27.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AK4, or adenylate kinase 4, is a member of the adenylate kinase family, which plays a crucial role in cellular energy homeostasis by catalyzing the interconversion of adenine nucleotides. It is primarily localized in mitochondria and is involved in maintaining ATP levels, particularly under conditions of cellular stress or in highly energetic tissues. Research has shown that AK4 may have implications in various physiological and pathological processes, including metabolic disorders and cancer, where altered energy metabolism is a hallmark. The study of AK4's structure and function is vital for understanding its role in mitochondrial dynamics and energy regulation. Moreover, due to its association with disease states, AK4 has become a potential biomarker and therapeutic target. Recent advancements in recombinant protein technology have facilitated the production of AK4 in its purified form, allowing for in-depth biochemical characterization and investigation of its enzymatic activities. Furthermore, the study of AK4 reconstitution plays a pivotal role in elucidating its mechanisms and potential interactions with other mitochondrial proteins, providing insights into its contribution to cellular function and dysfunction. Overall, ongoing research aims to decode the precise molecular functions of AK4, exploring its relevance in health and disease, and identifying potential strategies for targeting this enzyme in therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US