Analytical Data
-
Gene name
AK4
- Application
-
Alternative Names
AK4;GCN2;KIAA1338;eIF-2-alpha kinase GCN2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27144
-
Expression Region
1-223aa
-
AA Sequence
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
-
Molecular Weight
27.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AK4, or adenylate kinase 4, is a member of the adenylate kinase family, which plays a crucial role in cellular energy homeostasis by catalyzing the interconversion of adenine nucleotides. It is primarily localized in mitochondria and is involved in maintaining ATP levels, particularly under conditions of cellular stress or in highly energetic tissues. Research has shown that AK4 may have implications in various physiological and pathological processes, including metabolic disorders and cancer, where altered energy metabolism is a hallmark. The study of AK4's structure and function is vital for understanding its role in mitochondrial dynamics and energy regulation. Moreover, due to its association with disease states, AK4 has become a potential biomarker and therapeutic target. Recent advancements in recombinant protein technology have facilitated the production of AK4 in its purified form, allowing for in-depth biochemical characterization and investigation of its enzymatic activities. Furthermore, the study of AK4 reconstitution plays a pivotal role in elucidating its mechanisms and potential interactions with other mitochondrial proteins, providing insights into its contribution to cellular function and dysfunction. Overall, ongoing research aims to decode the precise molecular functions of AK4, exploring its relevance in health and disease, and identifying potential strategies for targeting this enzyme in therapeutic interventions.











