Analytical Data
-
Gene name
FAM19A3
- Application
-
Alternative Names
FAM19A3;FAM19A3;Chemokine-like Protein TAFA-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z5A8
-
Expression Region
31-169aa
-
AA Sequence
ALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCSCFSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGVRWSPACRGRSVRCSRTCRDGAAAVDTKSKPPRSHDSSWGSRPGQERLD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM19A3, a member of the FAM19 family, has garnered attention in recent years due to its potential role in various biological processes and diseases. This protein is primarily expressed in the central nervous system, where it is believed to be involved in neuroinflammation and neuronal signaling. Studies have shown that FAM19A3 may play a significant role in modulating the immune response in the brain, making it a candidate for research into neurodegenerative diseases, such as Alzheimer's disease and multiple sclerosis. Additionally, its expression patterns suggest a potential involvement in cancer biology, leading researchers to explore its implications in tumor progression and metastasis. FAM19A3 is also considered a promising biomarker for certain pathological conditions, further highlighting its significance in clinical research. The recombinant production of FAM19A3 protein allows for detailed structural and functional studies, facilitating a deeper understanding of its molecular mechanisms and interactions. This research avenue opens up possibilities for developing novel therapeutic strategies aimed at manipulating FAM19A3 activity for treating related disorders. Overall, the exploration of FAM19A3 as a recombinant protein is pivotal in elucidating its multifaceted roles in health and disease.











