Cat: PA1000-8949

Recombinant Human AGTR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AGTR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AGTR1;AGTR1A;AGTR1B;AT2R1;Type-1 angiotensin II receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P30556

  • Expression Region

    306-356aa

  • AA Sequence

    LFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCF

  • Molecular Weight

    41.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The angiotensin II type 1 receptor (AGTR1) is a key component of the renin-angiotensin system (RAS), which regulates blood pressure, fluid balance, and cardiovascular homeostasis. Dysregulation of AGTR1 is implicated in various pathologies, including hypertension, heart failure, and kidney diseases. The receptor's structure and function have attracted significant research attention, particularly concerning its role in mediating the effects of angiotensin II, a potent vasoactive peptide. Given the receptor's involvement in critical physiological processes and its potential as a therapeutic target, the generation of recombinant AGTR1 protein aids in elucidating the receptor's signaling mechanisms, ligand-binding properties, and interactions with downstream effectors. The study of AGTR1 through recombinant protein approaches enables the development of novel pharmacological agents aimed at modulating its activity, thus offering insights into new treatment strategies for RAS-related disorders. This research provides a foundation for understanding how AGTR1 contributes to disease mechanisms and informs the design of selective AGTR1 antagonists or modulators that could improve clinical outcomes for patients with cardiovascular and renal diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US