Cat: PA1000-133DB

Recombinant Human ALDOC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALDOC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALDOC;ALDC;Fructose-bisphosphate aldolase C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09972

  • Expression Region

    1-364aa

  • AA Sequence

    MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE NTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQD KGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRC VLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLK RCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIA MATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTF SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG GAAAQSLYIANHAY

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Aldose reductase (ALR) is a key enzyme in the polyol pathway, responsible for the reduction of glucose to sorbitol via NADPH. Its overactivity has been implicated in various diabetic complications, such as retinopathy, neuropathy, and nephropathy, highlighting its potential as a therapeutic target. Research into ALR has led to the exploration of its structure and function, leading to the development of recombinant proteins for screening potential inhibitors. The use of recombinant ALR not only facilitates a better understanding of its catalytic mechanisms but also aids in the identification of drug candidates that can selectively inhibit its activity. Advances in protein engineering techniques, such as mutagenesis and molecular modeling, have further enhanced the efficacy and specificity of these inhibitors. The integration of high-throughput screening methods has accelerated the discovery process, allowing for the rapid evaluation of thousands of compounds against the recombinant ALR. Overall, studies on ALR recombinant proteins are crucial for unraveling the complexities of diabetic complications and paving the way for novel therapeutic strategies aimed at alleviating the burden of diabetes-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US