Analytical Data
-
Gene name
Ag85A
- Application
-
Alternative Names
Ag85A；mpt44；Diacylglycerol acyltransferase/mycolyltransferase Ag85A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A5S8
-
Expression Region
53-331aa
-
AA Sequence
YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ag85A is a crucial protein derived from Mycobacterium tuberculosis, the bacterium responsible for tuberculosis (TB). It plays a significant role in the pathogenesis of the disease, as it is involved in the synthesis of the mycobacterial cell wall and is essential for the survival and virulence of the pathogen. The Ag85A protein has garnered considerable attention in the field of vaccine research due to its ability to elicit strong immune responses, making it a promising candidate for the development of novel TB vaccines. Understanding the structure and function of Ag85A is vital for enhancing vaccine efficacy and for the design of immunotherapeutic strategies against TB. Additionally, recombinant Ag85A proteins have been engineered to enhance immunogenicity and stability, which can improve their utility in vaccine formulations. As tuberculosis remains a significant global health challenge, with rising antibiotic resistance and the emergence of multidrug-resistant strains, research on Ag85A-recombinant proteins seeks not only to contribute to more effective vaccines but also to the overall understanding of TB immunology. This research aims to bridge the gaps in current vaccine strategies and potentially provide a pathway to control and ultimately eradicate tuberculosis.
