Analytical Data
-
Gene name
CRLF1
- Application
-
Alternative Names
CRLF1；Cytokine receptor-like factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75462
-
Expression Region
38-422aa
-
AA Sequence
AHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR
-
Molecular Weight
46.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRLF1 (Cytokine Receptor-Like Factor 1) is a member of the IL-6 cytokine receptor family, playing a pivotal role in hematopoiesis and immune responses. Research has increasingly focused on CRLF1 due to its association with various hematological disorders, notably its involvement in the pathogenesis of acute lymphoblastic leukemia (ALL). The emergence of CRLF1 as a critical receptor in mediating signaling pathways has spurred interest in understanding its structure and function through recombinant protein techniques. Producing CRLF1 as a recombinant protein allows scientists to investigate its biochemical properties, receptor interactions, and downstream signaling mechanisms in detail. This research not only elucidates CRLF1's role in normal physiological processes but also provides insights into its potential as a therapeutic target in malignancies associated with its dysregulation. Furthermore, characterizing CRLF1 can facilitate the development of novel diagnostic tools and treatment modalities, enhancing the clinical management of related diseases. Overall, the study of CRLF1 recombinant proteins holds significant promise for advancing our understanding of both normal immune function and the pathophysiological mechanisms underlying associated disorders.
