Analytical Data
-
Gene name
ATOH1
- Application
-
Alternative Names
ATOH1；ATH1；BHLHA14；Transcription factor ATOH1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92858
-
Expression Region
1-354aa
-
AA Sequence
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
-
Molecular Weight
40.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATOH1 (Atonal homolog 1) is a critical transcription factor involved in the development of various cell types, particularly in the nervous system and the inner ear, where it plays a pivotal role in the differentiation of hair cells. The study of ATOH1 recombinant protein has garnered attention due to its potential applications in regenerative medicine, especially for hearing loss caused by sensory cell damage. Research indicates that ATOH1 activation can promote the regeneration of hair cells in the cochlea, presenting a promising therapeutic strategy for hearing restoration. By producing ATOH1 as a recombinant protein, researchers can investigate its functional properties, interactions, and mechanisms of action in cellular environments. This has significant implications for understanding its role in auditory system development and offers insights for developing gene therapy approaches. Furthermore, elucidating the structure-function relationship of ATOH1 through recombinant protein studies can contribute to the identification of small molecules or peptides that can mimic its activity, enhancing the prospects for hearing recovery in clinical settings. As research progresses, the exploration of ATOH1 recombinant protein not only holds promise for innovative treatment options but also enhances our broader understanding of transcriptional regulation in cellular differentiation.
