Analytical Data
-
Gene name
FGL1
- Application
-
Alternative Names
FGL1；HFREP1；Fibrinogen-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q08830
-
Expression Region
23-312aa
-
AA Sequence
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVI DLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTV IQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTL KIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPE VQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYS GPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FGL1 (Fibroblast Growth Factor-like 1) is a protein that plays a significant role in various biological processes, including immune regulation and tissue repair. Recent research has highlighted its potential involvement in cancer progression and immune evasion, making it a target of interest in cancer immunotherapy. FGL1 has been identified as a ligand for the immune checkpoint receptor LAG-3 (Lymphocyte Activation Gene-3), which is known to inhibit T cell activation and promote immune tolerance. Consequently, understanding the mechanisms of FGL1 and its interactions with LAG-3 can provide insights into tumor microenvironments and how tumors evade immune responses. Additionally, recombinant FGL1 proteins have been utilized in experimental settings to elucidate their functional roles in modulating immune cell activity. These studies suggest that manipulating FGL1 pathways could enhance anti-tumor immunity, offering new avenues for therapeutic intervention. Given the increasing prominence of immune checkpoint inhibitors in cancer therapy, further investigation into FGL1 and its recombinant forms is crucial for developing more effective treatment strategies that can potentially overcome immune resistance in various malignancies.
