Analytical Data
-
Gene name
FCN2
- Application
-
Alternative Names
FCN2；FCNL；Ficolin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15485
-
Expression Region
26-313aa
-
AA Sequence
LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
-
Molecular Weight
33.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FCN2, or Ficolin-2, is a pattern recognition protein that plays a crucial role in the innate immune response by recognizing and binding to specific carbohydrate structures on pathogens. This protein is primarily produced in the liver and is involved in the opsonization of microorganisms, enhancing their clearance by phagocytic cells. Research into recombinant FCN2 has gained traction due to its potential therapeutic applications, including the development of novel immunotherapies and diagnostic tools. By expressing FCN2 as a recombinant protein in various systems, researchers can elucidate its functional characteristics, interactions with pathogens, and its role in modulating immune responses. Moreover, recombinant FCN2 can be used in clinical settings to assess its efficacy in treating infections or inflammatory diseases. Understanding the structure-function relationship of FCN2 through recombinant technology also paves the way for engineering variants with enhanced properties, ultimately contributing to improved strategies for disease prevention and treatment. As the global health landscape continues to evolve, exploring the therapeutic potential of FCN2 and its recombinant forms is becoming increasingly relevant in the pursuit of innovative solutions to combat infectious diseases and support immune health.
