Analytical Data
-
Gene name
CABP7
- Application
-
Alternative Names
CABP7;CALN2;Calcium-binding Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86V35
-
Expression Region
1-188aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDI PEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR LDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTV DELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI RQTCVRKS
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CABP7, or Calcium Binding Protein 7, is a member of the calmodulin superfamily and plays a critical role in cellular calcium signaling and various physiological processes. Research on CABP7 has intensified due to its potential involvement in neurodevelopment and synaptic plasticity, processes crucial for learning and memory. Its unique structure features distinct EF-hand motifs, which enable it to bind calcium ions effectively, leading to conformational changes that interact with various cellular targets, including ion channels and other signaling proteins. Mutations or dysregulation in CABP7 have been associated with certain neurodevelopmental disorders, making it a candidate for further investigation in the context of neurobiology and pharmacology. Additionally, understanding the functional dynamics of CABP7 can provide insights into the mechanisms underlying calcium signaling in neurons and other cell types, paving the way for therapeutic strategies to address related disorders. The recombinant expression of CABP7 permits detailed studies of its biochemical properties, binding affinities, and interaction networks, contributing to the broader understanding of calcium-binding proteins in health and disease. As such, the research on CABP7 is pivotal not only for elucidating its role in calcium signaling but also for exploring its potential as a biomarker or therapeutic target in neurodevelopmental conditions.











