Cat: PA1000-396DB

Recombinant Human CABP7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CABP7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CABP7;CALN2;Calcium-binding Protein 7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86V35

  • Expression Region

    1-188aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDI PEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQR LDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTV DELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI RQTCVRKS

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CABP7, or Calcium Binding Protein 7, is a member of the calmodulin superfamily and plays a critical role in cellular calcium signaling and various physiological processes. Research on CABP7 has intensified due to its potential involvement in neurodevelopment and synaptic plasticity, processes crucial for learning and memory. Its unique structure features distinct EF-hand motifs, which enable it to bind calcium ions effectively, leading to conformational changes that interact with various cellular targets, including ion channels and other signaling proteins. Mutations or dysregulation in CABP7 have been associated with certain neurodevelopmental disorders, making it a candidate for further investigation in the context of neurobiology and pharmacology. Additionally, understanding the functional dynamics of CABP7 can provide insights into the mechanisms underlying calcium signaling in neurons and other cell types, paving the way for therapeutic strategies to address related disorders. The recombinant expression of CABP7 permits detailed studies of its biochemical properties, binding affinities, and interaction networks, contributing to the broader understanding of calcium-binding proteins in health and disease. As such, the research on CABP7 is pivotal not only for elucidating its role in calcium signaling but also for exploring its potential as a biomarker or therapeutic target in neurodevelopmental conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US