Cat: PA1000-401DB

Recombinant Human CADM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CADM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CADM1;IGSF4;IGSF4A;NECL2;Cell adhesion molecule 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BY67

  • Expression Region

    45-374aa

  • AA Sequence

    QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKD SRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPP RNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEE WSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQ VHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLS GPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT TTTTTTTTTILTIITDSRAGEEGSIRAVDH

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CADM1 (Cell Adhesion Molecule 1), also known as SynCAM or Necl-2, is a member of the immunoglobulin superfamily and plays a crucial role in cell adhesion processes, particularly in the nervous system. Its primary function is to facilitate cell-cell interactions, which are essential for neuronal development, synaptogenesis, and maintaining synaptic integrity. Recent studies have highlighted the involvement of CADM1 in various physiological and pathological conditions, including neurodevelopmental disorders, brain tumors, and autoimmune diseases. The interest in CADM1 has surged due to its potential as a therapeutic target, especially in the context of neurological diseases. The production of recombinant CADM1 proteins allows researchers to investigate its functional properties, structural characteristics, and interactions with other cellular molecules in detail. By employing techniques such as ELISA, Western blotting, and immunofluorescence, researchers can explore how CADM1 influences cell behavior, signal transduction, and disease progression. Furthermore, understanding the role of CADM1 in neuronal health and disease may lead to innovative strategies for therapeutic intervention, making it a significant focus of ongoing biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US