Analytical Data
-
Gene name
CD2
- Application
-
Alternative Names
CD2;SRBC;T-cell surface antigen CD2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06729
-
Expression Region
25-209aa
-
AA Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKE KETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDL KIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITH KWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLD
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD2 is a surface glycoprotein primarily expressed on T cells and natural killer (NK) cells, playing a crucial role in the regulation of immune responses through its interactions with CD58, also known as LFA-3. This receptor-ligand interaction is fundamental for T cell activation, adhesion, and costimulation. The study of recombinant CD2 proteins has gained significant attention due to their potential applications in immunotherapy and vaccine development. By producing CD2 in a recombinant form, researchers aim to investigate its structural and functional properties, enhance our understanding of T cell dynamics, and explore its therapeutic potential in autoimmune diseases and cancer. Additionally, recombinant CD2 can be used to develop novel assays for the detection of T cell activation and to evaluate the efficacy of immunomodulatory treatments. The ability to manipulate and utilize this molecule in laboratory settings opens up new avenues for research and potentially improves therapeutic strategies aimed at modulating immune responses. Overall, the study of CD2 and its recombinant forms contributes to our knowledge of immune system regulation and holds promise for innovative approaches in clinical applications.











