Analytical Data
-
Gene name
CD59
- Application
-
Alternative Names
CD59；MIC11；MIN1；MIN2；CD59 glycoProtein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13987
-
Expression Region
26-102aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNC SSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLC NFNEQLEN
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD59, an important glycoprotein expressed on the surface of various cell types, plays a pivotal role in the regulation of the complement system, which is part of the innate immune response. It functions as an inhibitor of the membrane attack complex (MAC) formation, thus preventing lysis of host cells by complement proteins. The significance of CD59 in immune response and its involvement in various diseases, including autoimmune disorders, infections, and cancers, has spurred research into its structural and functional properties. Recombinant CD59 proteins are generated to study the mechanisms of complement inhibition and to explore therapeutic applications. Through techniques like genetic engineering and protein expression systems, researchers aim to produce functional and high-yield CD59 variants. These recombinant proteins not only serve as valuable tools for understanding the nuances of complement regulation but also hold potential for therapeutic interventions, such as enhancing tissue protection during complement-mediated damage or developing novel treatments for complement-related pathologies. Advanced studies on CD59, including its interactions with other complement components and the design of engineered variants, are crucial for unraveling its role in immune modulation and for paving the way for new therapeutic strategies. The ongoing research into CD59 recombinant proteins highlights their importance in both fundamental immunology and potential clinical applications.
