Analytical Data
-
Gene name
GHITM
- Application
-
Alternative Names
GHITM；DERP2；MICS1；TMBIM5；Growth hormone-inducible transmembrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3K2
-
Expression Region
1-345aa
-
AA Sequence
MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on GHITM (Glutamate Transporter Homologue from Escherichia coli) recombinant protein stems from the need to elucidate the mechanisms of glutamate transport and its implications in various physiological and pathological processes. Glutamate is a crucial neurotransmitter in the central nervous system, playing a vital role in synaptic transmission, learning, and memory. Dysregulation of glutamate transporters is linked to several neurological disorders, including Alzheimer's disease, schizophrenia, and epilepsy. GHITM, which is homologous to known mammalian glutamate transporters, provides a unique opportunity to study the structural and functional characteristics of this transporter in a simpler prokaryotic system. By expressing and purifying GHITM as a recombinant protein, researchers aim to analyze its transport properties, substrate specificity, and regulatory mechanisms. This study not only enhances our understanding of glutamate handling in cells but also holds potential for developing therapeutic strategies targeting glutamate dysregulation in neurological diseases. The successful characterization of GHITM may serve as a foundation for future research on other glutamate transporters and their roles in health and disease.
