Analytical Data
-
Gene name
CKS2
- Application
-
Alternative Names
CKS2；Cyclin-dependent kinases regulatory subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33552
-
Expression Region
1-79aa
-
AA Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
-
Molecular Weight
17.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CKS2 (Cyclin-Dependent Kinase Subunit 2) is a small, highly conserved protein that plays a critical role in the regulation of cell cycle progression and cellular responses to stress. Its involvement in various cellular processes, including the activation of cyclin-dependent kinases (CDKs), highlights its significance in cell proliferation and division. Recent studies have indicated that CKS2 is not only essential for normal cell cycle functions but also implicated in several pathologies, including cancer, where it is often overexpressed and associated with poor patient prognosis. This has sparked interest in understanding the molecular mechanisms by which CKS2 influences cellular behavior and its potential as a therapeutic target. Researchers are focusing on the structural and functional characterization of CKS2, including its interactions with CDKs and other regulatory proteins, to elucidate its role in cell cycle dysregulation. Recombination techniques are being employed to produce CKS2 fusion proteins for in vitro studies, which enable detailed analysis of its biochemical properties and interactions. Furthermore, investigations into the impact of CKS2 on signal transduction pathways provide insights into its multifaceted roles in maintaining cellular homeostasis. The ongoing research into CKS2 not only enhances our understanding of cell cycle regulation but also opens avenues for developing novel therapeutic strategies aimed at targeting cell proliferation in cancers and other diseases associated with cell cycle abnormalities.
