Analytical Data
-
Gene name
COMMD7
- Application
-
Alternative Names
COMMD7；C20orf92;COMM domain-containing Protein 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86VX2
-
Expression Region
1-200aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGRLHCTEDPVPEAVGGDMQQLNQLGA QQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLL VPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQ TLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIEL TLPQFYSFLHEMERVRTSMECFC
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COMMD7 (Copper Metabolism MURR1 domain-containing protein 7) is a member of the COMMD family, which is known for its roles in various cellular processes, including metal homeostasis, inflammation, and protein degradation. Research on COMMD7 has gained traction due to its involvement in copper metabolism and its potential implications in various diseases. The protein has been shown to regulate the activity of certain transcription factors and is implicated in the modulation of inflammatory responses and cell signaling pathways. Notably, mutations in the COMMD7 gene have been associated with conditions such as Wilson's disease, a genetic disorder resulting in copper accumulation in the body. Understanding the structure and function of COMMD7 is crucial for elucidating its role in copper regulation and disease pathology. Recent studies have focused on the recombinant expression of COMMD7 to investigate its biochemical properties, interactions with other proteins, and potential therapeutic applications. The use of recombinant technology allows for detailed analysis of COMMD7's mechanisms of action, paving the way for innovative approaches in treating diseases linked to copper dysregulation. Through these investigations, researchers aim to unveil the multifaceted roles of COMMD7, and its contributions to cellular homeostasis and disease, ultimately leading to targeted strategies for intervention.
