Cat: PA1000-9417

Recombinant Human SLC7A9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLC7A9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLC7A9;BAT1;b(0.+)-type amino acid transporter 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P82251

  • Expression Region

    1-487aa

  • AA Sequence

    MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFV SPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL MEAYGPIPAYLFSWASLIVIKPTSFAIICLSFSEYVCAPFYVGCKPPQIV VKCLAAAAILFISTVNSLSVRLGSYVQNIFTAAKLVIVAIIIISGLVLLA QGNTKNFDNSFEGAQLSVGAISLAFYNGLWAYDGWNQLNYITEELRNPYR NLPLAIIIGIPLVTACYILMNVSYFTVMTATELLQSQAVAVTFGDRVLYP ASWIVPLFVAFSTIGAANGTCFTAGRLIYVAGREGHMLKVLSYISVRRLT PAPAIIFYGIIATIYIIPGDINSLVNYFSFAAWLFYGLTILGLIVMRFTR KELERPIKVPVVIPVLMTLISVFLVLAPIISKPTWEYLYCVLFILSGLLF YFLFVHYKFGWAQKISKPITMHLQMLMEVVPPEEDPE

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLC7A9, a member of the solute carrier family, encodes a sodium-dependent cystine/glutamate transporter that plays a critical role in the uptake of cysteine and glutamate in various tissues, particularly in the kidneys and the central nervous system. This transporter is vital for maintaining cellular redox homeostasis and neurotransmitter balance, influencing numerous physiological processes. Dysregulation of SLC7A9 has been associated with various pathological conditions, including cystinuria—a genetic disorder leading to kidney stone formation—neurodegenerative diseases, and other metabolic disorders. To further understand its function and therapeutic potential, researchers have been focusing on the expression and characterization of recombinant SLC7A9 protein. This involves using various expression systems, such as bacterial or mammalian cells, to produce the protein in sufficient quantities for detailed functional studies, binding assays, and structural analysis. By elucidating the mechanistic insights into SLC7A9's transport activity and interactions with other ligands or proteins, these studies aim to pave the way for targeted interventions in related diseases and enhance our understanding of amino acid transport biology. The recombinant SLC7A9 protein serves as a crucial tool for both basic and applied biomedical research, facilitating the development of novel therapeutic approaches that could mitigate the impact of diseases linked to its dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US