Analytical Data
-
Gene name
LDHC
- Application
-
Alternative Names
LDHC；LDH3；LDHX；；L-lactate dehydrogenase C chain
-
Species
Human
-
Source
E. coli
-
Tag
His Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07864
-
Expression Region
1-332aa
-
AA Sequence
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
-
Molecular Weight
37kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
Lactate dehydrogenase C (LDHC) is an enzyme that plays a crucial role in the conversion of lactate to pyruvate, which is essential for cellular metabolism and energy production. Unlike other lactate dehydrogenases, LDHC is predominantly expressed in germ cells, particularly in testes, suggesting a specialized role in male fertility and spermatogenesis. Research has shown that LDHC is involved in regulating the metabolic switch necessary for sperm development and function. Abnormal expression or mutations in the LDHC gene have been associated with male infertility, making it a critical target for studies on reproductive health. The development of recombinant LDHC proteins allows for the exploration of its biochemical properties, functional mechanisms, and potential as a biomarker for male fertility issues. Furthermore, characterizing this protein can lead to advancements in understanding the metabolic pathways that support germ cell development and could provide insights into therapeutic strategies for treating infertility. Overall, studying LDHC in the context of recombinant protein technology is essential for dissecting its role in male reproductive biology and could pave the way for innovative clinical applications in reproductive medicine.
