Cat: PA1000-767DB

Recombinant Human CTLA4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTLA4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CTLA4;CD152;Cytotoxic T-lymphocyte Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16410

  • Expression Region

    37-162aa

  • AA Sequence

    AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCA ATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYP PPYYLGIGNGTQIYVIDPEPCPDSDF

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTLA-4 (Cytotoxic T-Lymphocyte Antigen 4) is an immune checkpoint receptor that plays a crucial role in regulating T cell-mediated immune responses. It is primarily expressed on the surface of activated T cells and functions as an inhibitory receptor that downregulates immune responses by competing with CD28 for binding to co-stimulatory ligands CD80 (B7-1) and CD86 (B7-2). The discovery of CTLA-4 provided significant insights into immune regulation and has paved the way for the development of immune checkpoint inhibitors in cancer therapy. These inhibitors, which block the activity of CTLA-4, enhance the immune system's ability to target and eliminate tumor cells. Numerous studies have demonstrated that the administration of CTLA-4 antagonists can lead to durable responses in various cancers, including melanoma and non-small cell lung cancer. However, the clinical application of CTLA-4 inhibitors is also associated with immune-related adverse events due to enhanced autoimmunity. Researchers are now focusing on engineering recombinant CTLA-4 proteins to understand their structure-function relationships better, optimize their therapeutic applications, and minimize adverse effects. Additionally, CTLA-4 recombinant proteins are being explored as potential biomarkers for patient stratification in immunotherapy and as tools for dissecting the complex mechanisms of immune regulation. Overall, the study of CTLA-4 and its recombinant proteins is a rapidly evolving field, bridging basic immunology research and advanced cancer treatments, with the potential to significantly improve patient outcomes in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US