Analytical Data
-
Gene name
CTLA4
- Application
-
Alternative Names
CTLA4；CD152;Cytotoxic T-lymphocyte Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16410
-
Expression Region
37-162aa
-
AA Sequence
AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCA ATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYP PPYYLGIGNGTQIYVIDPEPCPDSDF
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTLA-4 (Cytotoxic T-Lymphocyte Antigen 4) is an immune checkpoint receptor that plays a crucial role in regulating T cell-mediated immune responses. It is primarily expressed on the surface of activated T cells and functions as an inhibitory receptor that downregulates immune responses by competing with CD28 for binding to co-stimulatory ligands CD80 (B7-1) and CD86 (B7-2). The discovery of CTLA-4 provided significant insights into immune regulation and has paved the way for the development of immune checkpoint inhibitors in cancer therapy. These inhibitors, which block the activity of CTLA-4, enhance the immune system's ability to target and eliminate tumor cells. Numerous studies have demonstrated that the administration of CTLA-4 antagonists can lead to durable responses in various cancers, including melanoma and non-small cell lung cancer. However, the clinical application of CTLA-4 inhibitors is also associated with immune-related adverse events due to enhanced autoimmunity. Researchers are now focusing on engineering recombinant CTLA-4 proteins to understand their structure-function relationships better, optimize their therapeutic applications, and minimize adverse effects. Additionally, CTLA-4 recombinant proteins are being explored as potential biomarkers for patient stratification in immunotherapy and as tools for dissecting the complex mechanisms of immune regulation. Overall, the study of CTLA-4 and its recombinant proteins is a rapidly evolving field, bridging basic immunology research and advanced cancer treatments, with the potential to significantly improve patient outcomes in oncology.
