Cat: PA1000-815DB

Recombinant E.coli cysH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    cysH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    cysH;Phosphoadenosine 5'-phosphosulfate reductase

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17854

  • Expression Region

    1-244aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSKLDLNALNELPKVDRILALAETNAELEK LDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTG YLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEK YNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVL PIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEEET RFFGLKRECGLHEG

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the cysH recombinant protein stems from its critical role in the biosynthesis of cofactor molybdenum, an essential element for various enzymatic reactions in organisms. CysH, a known enzyme, is involved in the synthesis of cysteine and the metabolism of sulfur-containing compounds, which are vital for cellular functions and processes such as antioxidant defense and protein synthesis. Given the increasing interest in biotechnological applications and the potential for finding novel therapeutic targets, understanding cysH at the molecular level has gained significant attention. Researchers aim to elucidate its structure-function relationship, optimize its expression in heterologous systems, and explore its kinetic properties and regulatory mechanisms. By producing recombinant cysH, scientists can investigate its enzymatic activity, interactions with other biomolecules, and its impact in various metabolic pathways. This research not only enhances our comprehension of sulfur metabolism but may also lead to advancements in fields like synthetic biology, where engineering microbial strains for bioproduction of pharmaceuticals or biofuels is of prime interest. Furthermore, studying cysH could contribute to the understanding of certain disease mechanisms linked to sulfur metabolism, opening avenues for innovative therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US