Analytical Data
-
Gene name
ZNF384
- Application
-
Alternative Names
ZNF384；CAGH1；CIZ；NMP4；Zinc finger Protein 384
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TF68
-
Expression Region
1-245aa
-
AA Sequence
MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI
-
Molecular Weight
53.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF384 (Zinc Finger Protein 384) is a transcription factor that belongs to the Krüppel-like zinc finger protein family, playing a crucial role in various biological processes, including cell differentiation, proliferation, and development. Research has indicated that ZNF384 is involved in hematopoiesis and is essential for normal immune function. Notably, abnormalities in ZNF384 expression or function have been implicated in hematological malignancies, including acute myeloid leukemia (AML). Studies show that ZNF384 can act as an oncogene, driving the proliferation of cancer cells when aberrantly expressed. The recombinant protein of ZNF384 has become a focal point for investigation, enabling researchers to explore its structure-function relationship, identify potential binding partners, and elucidate its role in transcriptional regulation. Additionally, understanding the mechanisms by which ZNF384 influences gene expression could reveal novel therapeutic targets for treating related diseases. As scientists continue to investigate the pathways regulated by ZNF384, the recombinant protein serves as a vital tool for dissecting its functional properties and therapeutic potential in cancer biology and other related fields.
