Cat: PA1000-875DB

Recombinant Human DHRS4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DHRS4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DHRS4;SDR25C2;Dehydrogenase/reductase SDR family member 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BTZ2

  • Expression Region

    1-278aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMHKAGLLGLCARAWNSVRMASSGMTR RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATL QGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSI MDVTEEVWDKTLDINVKAPALMTKAVVPEMMHKAGLLGLCARAWNSVRMA SSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQEKRG GGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCL APGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDA SYITGETVVVGGGTPSRL

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DHRS4 (Dehydrogenase/reductase 4) is a member of the short-chain dehydrogenase/reductase (SDR) family, which plays a critical role in the metabolism of various endogenous and exogenous compounds, including steroids, retinoids, and xenobiotics. The study of DHRS4 has gained prominence due to its involvement in crucial biological processes, such as cellular signaling, apoptosis, and oxidative stress response. Additionally, DHRS4 is expressed in various tissues, highlighting its potential relevance in both normal physiological functions and disease states. Recent research has indicated that DHRS4 may influence cancer progression, metabolic disorders, and neurodegenerative diseases, making it an attractive target for therapeutic intervention. Structural studies have revealed unique features of DHRS4 that may distinguish it from other SDRs, which could provide insights into its substrate specificity and mechanism of action. Given the increasing recognition of the importance of DHRS4, ongoing investigations aim to elucidate its biochemical properties, regulatory mechanisms, and potential as a biomarker or therapeutic target, paving the way for new approaches in treating related diseases and improving health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US