Analytical Data
-
Gene name
rpsJ
- Application
-
Alternative Names
rpsJ；nusE；Small ribosomal subunit Protein uS10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A7R5
-
Expression Region
1-103aa
-
AA Sequence
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
-
Molecular Weight
38.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RpsJ, or ribosomal protein S10, is a crucial component of the ribosomal assembly and function in bacterial cells. Its primary role is to contribute to the structural integrity of the ribosome, facilitating protein synthesis, which is essential for cell growth and proliferation. Given the significance of ribosomal proteins in cellular functions, research on RpsJ has garnered attention, particularly in its implications for antibiotic resistance and as a potential target for novel antimicrobial agents. Many bacteria, including pathogenic strains, rely on their ribosomal machinery for survival and virulence, making RpsJ a noteworthy subject for genetic and biochemical studies. Recombinant protein production of RpsJ allows for detailed investigation into its structure, interaction with ribosomal RNA, and role in ribosome assembly. Additionally, understanding the molecular mechanisms by which RpsJ influences ribosome function could provide insights into the evolutionary adaptations of bacteria and their response to environmental stresses. This research is instrumental in developing strategies to combat bacterial infections, especially in the face of rising antibiotic resistance, by identifying new pathways for intervention. Thus, the study of recombinant RpsJ not only expands our knowledge of ribosomal biology but also holds promise for the development of innovative therapeutic approaches in the fight against bacterial diseases.
