Cat: PA1000-9537

Recombinant Human CFTR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CFTR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CFTR;ABCC7;Cystic fibrosis transmembrane conductance regulator

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13569

  • Expression Region

    1381-1480aa

  • AA Sequence

    YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKL LNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The cystic fibrosis transmembrane conductance regulator (CFTR) is a vital protein that functions as a chloride channel in epithelial cells, playing a crucial role in maintaining the balance of salt and water across cell membranes. Mutations in the CFTR gene lead to cystic fibrosis (CF), a genetic disorder characterized by thick mucus production, respiratory problems, and impaired pancreatic function. Research on CFTR recombinant proteins has gained significant attention due to their potential to elucidate the mechanisms underlying CFTR function and dysfunction. The study of CFTR's structure, dynamics, and interaction with various cellular components is essential for understanding the molecular basis of CF and developing targeted therapies. By employing techniques such as protein expression in heterologous systems, site-directed mutagenesis, and advanced imaging methods, scientists aim to dissect the channel's gating mechanisms and ion transport properties. Furthermore, the characterization of CFTR recombinant proteins offers insights into how specific mutations affect its function, paving the way for the design of novel pharmacological agents, such as small molecules and gene therapies, that could restore CFTR activity and improve outcomes for individuals with cystic fibrosis. As research progresses, the integration of structural biology, biophysics, and pharmacology continues to enhance our understanding of CFTR, highlighting its significance as a therapeutic target and a model for studying ion channel diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US