Analytical Data
-
Gene name
NGB
- Application
-
Alternative Names
NGB；Neuroglobin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPG2
-
Expression Region
1-151aa
-
AA Sequence
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
-
Molecular Weight
32.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NGB, or neuroglobin, is a heme-containing protein primarily expressed in neurons and glial cells, playing a crucial role in oxygen transport and protection against oxidative stress in the central nervous system. Its discovery in 2000 marked a significant advancement in our understanding of neuronal physiology. Research indicates that NGB may provide neuroprotective effects in various neurological disorders, such as Alzheimer's disease, Parkinson's disease, and ischemic injury, by scavenging reactive oxygen species and facilitating cellular respiration. The interest in NGB has intensified as studies reveal its potential to influence cellular metabolism and neuronal survival mechanisms. Current research is focused on the characterization of recombinant NGB (rNGB) to explore its biochemical properties and therapeutic applications. By producing rNGB in heterologous systems, scientists aim to investigate its structure-function relationships, as well as its interactions with other biomolecules, including reactive oxygen species and neurotoxic agents. Additionally, the potential use of rNGB in drug development and gene therapy for neurodegenerative diseases is being actively pursued, highlighting its significance in both basic and applied research. Overall, the ongoing investigation into NGB and its recombinant forms provides valuable insights into neurobiology, with the promise of new strategies for combating neurodegenerative conditions and promoting neuronal health.
