Analytical Data
-
Gene name
ltxA
- Application
-
Alternative Names
ltxA；AaLta；lktA；Leukotoxin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16462
-
Expression Region
721-1055aa
-
AA Sequence
IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA
-
Molecular Weight
38.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ltxA gene encodes for a protein known as the leukotoxin A, produced by various strains of *Actinobacillus pleuropneumonia* and certain other bacteria. This protein plays a critical role in the pathogenesis of respiratory diseases in pigs, leading to severe pleuropneumonia, which poses significant economic challenges in the swine industry. The study of ltxA recombinant protein has gained attention due to its potential applications in vaccine development and as a tool for understanding host-pathogen interactions. The ability of ltxA to induce apoptosis in immune cells, particularly neutrophils and lymphocytes, highlights its role in immune evasion and disease progression. Researchers have been focused on characterizing the mechanisms of its action, the structure-function relationships of the protein, and its interactions with the immune system. By utilizing recombinant DNA technology, scientists can produce ltxA in a controlled environment, enabling detailed investigations and the development of interventions to mitigate the impact of infections caused by *A. pleuropneumonia*. Understanding the ltxA protein can also provide insights into similar toxins in other pathogenic bacteria, thereby contributing to broader implications in microbiology and immunology.
