Analytical Data
-
Gene name
AMH
- Application
-
Alternative Names
AMH；AMHR；MISR2；Anti-Muellerian hormone type-2 receptor
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27106
-
Expression Region
450-552aa
-
AA Sequence
DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYG NHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVA TEC
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Anti-Müllerian hormone (AMH) is a glycoprotein involved in the regulation of sexual differentiation and gonadal development. Initially identified in male fetal testes, AMH plays a critical role in inhibiting the development of female reproductive structures, thereby promoting male characteristics. In recent years, understanding the biological functions and signaling pathways of AMH has garnered significant interest, particularly in reproductive biology and endocrinology. Research has highlighted the hormone's role in ovarian follicle development and its potential as a biomarker for ovarian reserve and fertility. Additionally, the recombinant form of AMH has been explored for therapeutic applications in managing conditions such as polycystic ovary syndrome (PCOS), premature ovarian insufficiency, and other reproductive disorders. The ability to produce recombinant AMH in a laboratory setting has facilitated detailed studies on its molecular structure, function, and potential clinical applications, making it a focal point in both basic and applied research within reproductive health.
