Analytical Data
-
Gene name
EPOR
- Application
-
Alternative Names
EPOR;Erythropoietin receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19235
-
Expression Region
25-250aa
-
AA Sequence
APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRV TAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARM AEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of EPOR (Erythropoietin Receptor) and its recombinant proteins has gained significant attention due to its critical role in erythropoiesis, the process of producing red blood cells. Erythropoietin (EPO), a hormone primarily produced in the kidneys, binds to EPOR to stimulate red blood cell production, making it a crucial factor in treating various anemias, particularly in patients with chronic kidney disease or those undergoing chemotherapy. However, dysregulation of the EPOR signaling pathway can lead to disorders such as polycythemia or anemia. Recent advancements in recombinant DNA technology have enabled the production of modified EPOR proteins with enhanced therapeutic potential, aimed at improving efficacy, reducing side effects, and refining treatment protocols. Furthermore, understanding the structural and functional aspects of EPOR is vital for the development of new drugs and therapeutic strategies. Researchers are investigating the intricate signaling mechanisms, receptor dynamics, and the interaction of EPOR with other cellular pathways to uncover the nuances of its function. Additionally, exploring the potential of EPOR-related therapies in regenerative medicine and its implications in cancer biology are expanding the scope of research. This background sets the stage for ongoing studies focused on optimizing EPOR-based therapies, understanding its role in various physiological and pathological contexts, and addressing the challenges presented by its clinical applications.
