Cat: PA1000-1055

Recombinant Human ETNK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ETNK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ETNK2;EKI2;Ethanolamine kinase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NVF9

  • Expression Region

    1-386aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAVPPSAPQPRASFHLRRHTPCPQCSW GMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQELRPH WKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENE VRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIAL EMAKIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLER ELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQ AFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQ RLYVQVNKFALASHFFWALWALIQNQYSTIDFDFLRYAVIRFNQYFKVKP QASALEMPK

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ETNK2 (Ectonucleotide Triphosphate Diphosphohydrolase 2) is a crucial enzyme involved in purinergic signaling and nucleotide metabolism, playing a significant role in cellular processes such as proliferation, differentiation, and apoptosis. As a member of the ecto-nucleotide triphosphate diphosphohydrolase family, ETNK2 is responsible for the hydrolysis of extracellular nucleotides, which can impact various physiological and pathological conditions, including inflammation, cancer, and neurodegenerative diseases. Recent studies have highlighted the relevance of ETNK2 in modulating purinergic signaling pathways, suggesting that altered ETNK2 activity may contribute to disease progression. The recombinant expression of ETNK2 in suitable systems has become essential for elucidating its biochemical functions and potential therapeutic applications. By producing ETNK2 in a controlled environment, researchers can study its enzymatic properties, interaction with substrates, and regulatory mechanisms. Characterizing this enzyme at the molecular level not only enhances the understanding of its role in cellular metabolism but also paves the way for developing targeted therapies that can manipulate its activity. The investigation of ETNK2 as a potential biomarker for specific diseases presents new avenues for early diagnosis and intervention, underscoring the importance of recombinant protein studies in advancing biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US