Analytical Data
-
Gene name
LAMP5
- Application
-
Alternative Names
LAMP5；C20orf103；Lysosome-associated membrane glycoProtein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJQ1
-
Expression Region
1-280aa
-
AA Sequence
MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG
-
Molecular Weight
31.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMP5 (Lysosomal Associated Membrane Protein 5) is an integral membrane protein predominantly expressed in the brain and is a member of the LAMP family, which plays a crucial role in lysosomal function and cellular homeostasis. The study of LAMP5 is particularly significant in the context of neurodegenerative diseases, where lysosomal dysfunction is increasingly recognized as a contributing factor. Research has indicated that LAMP5 may be involved in autophagy and the degradation of neurotoxic proteins, making it a potential target for therapeutic interventions. Additionally, LAMP5 expression has been linked to synaptic activity and plasticity, suggesting its possible involvement in cognitive functions and neurodevelopmental processes. The development and characterization of recombinant LAMP5 proteins have enabled scientists to explore its structure-function relationships, interaction partners, and regulations in various biological contexts. By investigating the molecular mechanisms underlying LAMP5's role in health and disease, researchers aim to uncover novel insights that could lead to innovative strategies for treating neurological disorders, ultimately enhancing our understanding of lysosomal biology and its implications for brain health.
