Analytical Data
-
Gene name
GPM1
- Application
-
Alternative Names
GPM1；Phosphoglycerate mutase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00950
-
Expression Region
2-247aa
-
AA Sequence
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAVANQGKK
-
Molecular Weight
29.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPM1, or phosphoglycerate mutase 1, is a key enzyme involved in the glycolytic pathway, facilitating the conversion of 3-phosphoglycerate to 2-phosphoglycerate, a crucial step in energy metabolism. Research on recombinant GPM1 protein has gained significant attention due to its potential implications in various biological processes and diseases. The enzyme is highly conserved across species, indicating its fundamental role in cellular metabolism. Dysregulation of GPM1 has been linked to metabolic disorders and cancer, making it a target for therapeutic intervention. The study of recombinant GPM1 not only aids in understanding its structural and functional properties but also provides insights into its enzymatic mechanisms. Moreover, the production of recombinant GPM1 in heterologous systems allows for the assessment of its activity under different conditions, contributing to the exploration of its role in metabolic pathways. As researchers continue to investigate GPM1, the insights gained could pave the way for novel strategies in targeting metabolic diseases and improving energy metabolism. This growing body of knowledge underscores the importance of GPM1 in both basic and applied research, making it a significant focus within the fields of biochemistry and molecular biology.
