Analytical Data
-
Gene name
FAM84B
- Application
-
Alternative Names
FAM84B；BCMP101；FAM84B;Protein LRATD2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96KN1
-
Expression Region
1-310aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMGNQVEKLTHLSYKEVPTADPTGVDRD DGPRIGVSYIFSNDDEDVEPQPPPQGPDGGGLPDGGDGPPPPQPQPYDPR LHEVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQ AQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQGRRGRVVNDLYRYKPLS SSAVVRNALAHVGAKERELSWRNSESFAAWCRYGKREFKIGGELRIGKQP YRLQIQLSAQRSHTLEFQSLEDLIMEKRRNDQIGRAAVLQELATHLHPAE PEEGDSNVARTTPPPGRPPAPSSEEEDGEAVAH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM84B (Family with Sequence Similarity 84 Member B) is a relatively understudied protein within the field of molecular biology, yet it has garnered attention due to its potential roles in cellular processes and disease mechanisms. Located on chromosome 9, FAM84B has been implicated in various cellular pathways, including cell proliferation, differentiation, and survival. Emerging research suggests that alterations in FAM84B expression or function may contribute to tumorigenesis and cancer progression, particularly in certain types of malignancies. Its association with oncogenic pathways positions it as a candidate biomarker for cancer diagnosis and prognosis. Additionally, FAM84B's interactions with other signaling molecules and proteins hint at a complex regulatory role within the cell. Given the increasing recognition of the significance of non-canonical oncogenes and their associated pathways in cancer biology, a comprehensive understanding of FAM84B’s structure, function, and regulatory mechanisms is crucial. This necessitates the development of recombinant proteins for characterizing FAM84B's biological functions and its molecular interactions. Such studies could illuminate its potential as a therapeutic target, thereby advancing cancer treatment strategies. Understanding the nuanced role of FAM84B in health and disease is essential for harnessing its therapeutic potential, thereby emphasizing the need for continued investigation into this intriguing protein.
