Cat: PA1000-1086

Recombinant Human FAM50A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FAM50A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FAM50A;DXS9928E;HXC26;Protein FAM50A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14320

  • Expression Region

    150-339aa

  • AA Sequence

    TTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQL MYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKD ESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FAM50A, a member of the FAM50 gene family, has garnered attention in recent years due to its potential role in various biological processes and diseases. Initially identified as a gene involved in cellular proliferation and differentiation, FAM50A is believed to participate in the regulation of gene expression and chromatin structure. Its expression patterns have been implicated in various cancers, making it a candidate for targeted therapies and biomarker development. In addition, studies suggest that FAM50A may be involved in the cellular response to stress and apoptosis, highlighting its importance in maintaining cellular homeostasis. The production of recombinant FAM50A protein allows researchers to investigate its functional properties, interactions with other proteins, and its mechanistic pathways in greater detail. Understanding the structure and function of the FAM50A protein may provide insights into its role in human health and disease, opening avenues for potential therapeutic interventions. As research progresses, characterizing the recombinant FAM50A protein could lead to novel discoveries regarding its involvement in cellular signaling pathways and its potential as a drug target in the treatment of cancers and other diseases. Overall, the study of FAM50A and its recombinant protein forms represents a promising frontier in molecular biology, with implications for both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US