Cat: PA1000-1090

Recombinant Human FARS2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FARS2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FARS2;FARS1;Phenylalanine--tRNA ligase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95363

  • Expression Region

    37-451aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPAAECATQRAPGSVVELLGKSYPQDDHSN LTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDN LSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLH AGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESL QLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVD CYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLG LERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVIN DISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYR ITYRHMERTLSQREVRHIHQALQEAAVQLLGVEGRF

  • Molecular Weight

    51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FARS2 (PhenylalanyltRNA synthetase 2) is a mitochondrial enzyme that plays a crucial role in the protein synthesis process by attaching the amino acid phenylalanine to its corresponding tRNA. Deficiencies or mutations in FARS2 have been linked to various mitochondrial disorders and neurological conditions, highlighting its significance in cellular health and function. Recent studies have demonstrated that FARS2 is essential for mitochondrial protein synthesis and overall mitochondrial function, making it a potential target for therapeutic interventions. Researchers have focused on the recombinant production of FARS2 to explore its structural and functional properties, which could provide insights into its enzymatic mechanisms and interactions with other mitochondrial components. Furthermore, understanding the nuances of FARS2 function may lead to the development of novel strategies to address diseases associated with mitochondrial dysfunction. By using recombinant technology, scientists can generate large quantities of FARS2 for biochemical assays and structural biology studies, paving the way for advancements in targeted therapies for mitochondrial diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US