Cat: PA1000-1097

Recombinant Human FBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FBP2;Fructose-1.6-bisphosphatase isozyme 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00757

  • Expression Region

    1-339aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTDRSPFETDMLTLTRYVMEKGRQAKG TGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVL SNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNI DCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALS TGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEY VQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLR LLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQE YLTCVQKNQAGS

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FBP2 (Fructose-1,6-bisphosphatase 2) is an important enzyme involved in gluconeogenesis, which plays a crucial role in glucose homeostasis and energy metabolism. It catalyzes the conversion of fructose-1,6-bisphosphate to fructose-6-phosphate, a key regulatory step in carbohydrate metabolism. Research on FBP2 has gained significance due to its potential implications in metabolic disorders such as diabetes and obesity. Aberrant regulation of FBP2 activity can lead to altered glucose production and utilization, contributing to hyperglycemia and insulin resistance. Moreover, FBP2 is also linked to tumor metabolism, making it a target of interest in cancer research. Understanding the structure and function of FBP2 at the molecular level through recombinant protein studies can provide insights into its regulatory mechanisms and potential therapeutic applications. By utilizing recombinant DNA technology, researchers can produce FBP2 in heterologous systems, allowing for detailed biochemical and biophysical characterization. This research can pave the way for drug discovery and the development of innovative therapeutic strategies aimed at modulating FBP2 activity, providing new avenues for the treatment of metabolic diseases and cancer.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US