Analytical Data
-
Gene name
GRA3
- Application
-
Alternative Names
GRA3；Glycine receptor subunit alpha-3
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B6KEU8
-
Expression Region
43-114aa
-
AA Sequence
ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK
-
Molecular Weight
10.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GRA3, or GRA3 protein, is an important component of the parasitic organism Toxoplasma gondii, which is known for its significant impact on human health and agriculture. T. gondii is an intracellular parasite that can cause toxoplasmosis, a disease that affects millions of people worldwide, particularly immunocompromised individuals and pregnant women. GRA3 is part of a group of proteins known as “Dense Granule Antigens” (GRA), which are secreted by the parasite during its invasion of host cells. These proteins play a crucial role in modulating the host's immune response and establishing an intracellular niche conducive to the parasite's survival. Research on GRA3 has gained attention due to its potential as a target for vaccine development and therapeutic intervention, as understanding its structure and function may reveal insights into the parasite's biology and its interactions with the host immune system. Studies have shown that GRA3 can influence various signaling pathways within the host cells, thus helping the parasite evade immune detection and enhancing its pathogenicity. Moreover, the investigation of GRA3's molecular characteristics may provide valuable information for the development of diagnostic tools and novel treatment strategies, particularly in regions with high prevalence rates of T. gondii infections. As such, ongoing research into GRA3 is critical for addressing the public health challenges posed by toxoplasmosis and advancing our understanding of host-parasite interactions in the context of infectious diseases.
