Analytical Data
-
Gene name
Des
- Application
-
Alternative Names
Des；Desmin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17661
-
Expression Region
2-470aa
-
AA Sequence
SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
-
Molecular Weight
80.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Desmin is a crucial protein belonging to the intermediate filament family, predominantly expressed in muscle tissues, where it plays a vital role in maintaining cellular structure and integrity. Its primary function is to connect the contractile apparatus of muscle cells to the plasma membrane and to other cytoskeletal elements, thereby facilitating muscle contraction and promoting cellular stability. Mutations or deficiencies in the desmin gene can lead to a range of myopathies, including desmin-related myopathy, characterized by muscle weakness, atrophy, and cardiomyopathy. Research into desmin and its recombinant forms has gained significant attention due to their potential implications in understanding muscle pathology and developing therapeutic strategies. The study of desmin-based recombinants aims to elucidate the molecular mechanisms underlying muscle disorders and to explore avenues for tissue engineering and regenerative medicine. By harnessing the properties of desmin, researchers are investigating its use in the development of bioengineered tissues, which could lead to innovations in treating muscle degeneration and other related diseases. Consequently, the study of desmin not only enhances our understanding of muscle biology but also holds promise for advancing therapeutic approaches for myopathies.
