Analytical Data
-
Gene name
U100
- Application
-
Alternative Names
U100；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9QJ11
-
Expression Region
25-354aa
-
AA Sequence
TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK
-
Molecular Weight
44.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The U100 recombinant protein has emerged as a focal point in biotechnology and pharmaceutical research due to its potential applications in various fields, including therapeutics, diagnostics, and vaccine development. Recent advancements in protein engineering and expression systems have enabled the efficient production of U100, a protein characterized by its unique structure and functional properties. Researchers are particularly interested in its role in modulating immune responses and its potential as a drug target for diseases such as cancer and autoimmune disorders. The ability to produce U100 in recombinant systems allows for high yields and purity, making it suitable for further studies. Investigations into its stability, activity, and interactions within biological systems are crucial for understanding its mechanisms and potential applications. As interest in personalized medicine grows, U100 could play a pivotal role in the development of targeted therapies, offering hope for improved patient outcomes. Ongoing research aims to unveil the full spectrum of U100's biological functions and its implications in health and disease, driving innovation in treatment strategies and contributing to the broader field of protein-based therapeutics.
