Cat: PA1000-9751

Recombinant Human ADAM17 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAM17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAM17;CSVP;TACE;Disintegrin and metalloProteinase domain-containing Protein 17

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78536

  • Expression Region

    215-671aa

  • AA Sequence

    RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRN TSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDV KMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGV CPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAE HDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIES KAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQC SDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDD TVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSCKVCCRDLSGRCVPY VDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLSINTF GKFLADN

  • Molecular Weight

    51 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAM17, also known as A Disintegrin and Metalloproteinase 17, is a crucial member of the ADAM family of proteins, which play significant roles in cell signaling, adhesion, and the ectodomain shedding of various membrane proteins. Its primary functions include the cleavage of pro-inflammatory cytokines and growth factors, making it pivotal in inflammatory processes and tissue remodeling. Dysregulation of ADAM17 has been implicated in various pathological conditions, including cancer, autoimmune diseases, and cardiovascular disorders. Given its involvement in important physiological and pathological mechanisms, the recombinant production of ADAM17 has gained attention in research. By creating recombinant ADAM17 proteins, scientists can study the protein's biological functions, enzyme kinetics, and interactions with substrates in a controlled manner. This research can help elucidate the role of ADAM17 in disease processes and may pave the way for the development of targeted therapies that inhibit or modulate its activity. Additionally, recombinant ADAM17 can serve as a valuable tool for screening potential inhibitors and understanding the molecular mechanisms that govern its activity. Thus, the study of recombinant ADAM17 is not only essential for understanding its biological significance but also for exploring its potential as a therapeutic target in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US